PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_25C93FD29.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 169aa    MW: 19485.2 Da    PI: 10.7052
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_25C93FD29.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-172370148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT eEd ll+++++  G g+W++ ar+ g++Rt+k+c++rw++yl
  Traes_2AS_25C93FD29.1 23 RGPWTVEEDVLLANYIAANGEGRWNALARRAGLKRTGKSCRLRWLNYL 70
                           89********************************************97 PP

2Myb_DNA-binding53.17.4e-1776119146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg +T+eE++l +++++++G++ W++Ia++++ gRt++++k++w++
  Traes_2AS_25C93FD29.1  76 RGGMTAEEQLLVLELHARWGNR-WSKIAQHLP-GRTDNEIKNYWRT 119
                            6789******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.7891870IPR017930Myb domain
SuperFamilySSF466892.4E-2922117IPR009057Homeodomain-like
SMARTSM007172.4E-142272IPR001005SANT/Myb domain
PfamPF002492.8E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-212477IPR009057Homeodomain-like
CDDcd001675.39E-102570No hitNo description
PROSITE profilePS5129423.28971125IPR017930Myb domain
SMARTSM007177.9E-1575123IPR001005SANT/Myb domain
PfamPF002491.1E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2378124IPR009057Homeodomain-like
CDDcd001672.94E-1179119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MACDQRGMRG EETAAGEEEM LRRGPWTVEE DVLLANYIAA NGEGRWNALA RRAGLKRTGK  60
SCRLRWLNYL RPDLRRGGMT AEEQLLVLEL HARWGNRWSK IAQHLPGRTD NEIKNYWRTR  120
VQRHAKQLRC DVGSQRFRDL VRGLWIPRLL ERIHAANSSG EGDVIAQAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-25201231103C-Myb DNA-Binding Domain
1msf_C1e-25201231103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686900.0AK368690.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2078D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645266.12e-86PREDICTED: myb-related protein 340
SwissprotQ9LDE11e-72MY108_ARATH; Transcription factor MYB108
TrEMBLW5B0581e-120W5B058_WHEAT; Uncharacterized protein
STRINGLOC_Os07g48870.17e-86(Oryza sativa Japonica Group)
STRINGORGLA07G0213800.17e-86(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.11e-77myb domain protein 112
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]